PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr024420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 196aa    MW: 22311 Da    PI: 7.1445
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr024420.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
      Pbr024420.1 17 KGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYL 64
                     79********************************************97 PP

2Myb_DNA-binding55.81.1e-1770113146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+ ++++++G++ W++Ia++++ gRt++++k++w++
      Pbr024420.1  70 RGNITPEEQLLIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 113
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-231067IPR009057Homeodomain-like
PROSITE profilePS5129416.0661264IPR017930Myb domain
SuperFamilySSF466891.12E-3015111IPR009057Homeodomain-like
SMARTSM007177.2E-131666IPR001005SANT/Myb domain
PfamPF002492.4E-161764IPR001005SANT/Myb domain
CDDcd001672.38E-101964No hitNo description
PROSITE profilePS5129425.85965119IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2568119IPR009057Homeodomain-like
SMARTSM007171.8E-1569117IPR001005SANT/Myb domain
PfamPF002491.5E-1670113IPR001005SANT/Myb domain
CDDcd001671.75E-1274113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MDKNPCNSSS QDVEVRKGPW TMEEDLILIN YIANHGEGVW NSLAKAAGLK RTGKSCRLRW  60
LNYLRPDVRR GNITPEEQLL IMELHAKWGN RWSKIAKHLP GRTDNEIKNY WRTRIQKHIK  120
QAENITPGQS SEVNDQASTS QVSISKTLDT MDISHSAPTH QANMDAYPPP LPADQSNDNY  180
WSMEDLWSMQ LLNGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-26611913128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009334094.11e-145PREDICTED: myb-related protein 305-like
SwissprotP813911e-101MYB05_ANTMA; Myb-related protein 305
TrEMBLM5XIW31e-124M5XIW3_PRUPE; Uncharacterized protein
STRINGVIT_14s0066g01090.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.12e-91myb domain protein 24